Lineage for d112m__ (112m -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44565Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries)
  8. 44683Domain d112m__: 112m - [15135]

Details for d112m__

PDB Entry: 112m (more details), 2.34 Å

PDB Description: sperm whale myoglobin d122n n-propyl isocyanide at ph 9.0

SCOP Domain Sequences for d112m__:

Sequence; same for both SEQRES and ATOM records: (download)

>d112m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d112m__:

Click to download the PDB-style file with coordinates for d112m__.
(The format of our PDB-style files is described here.)

Timeline for d112m__: