SCOPe 2.05: Domain d2qtia_: 2qti A:

Lineage for d2qtia_ (2qti A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Uncharacterized protein SO2176 [158661] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [158662] (2 PDB entries)
   Uniprot Q8EF26 1-72

8. Domain d2qtia_: 2qti A: [151349]
   automated match to d2juwa1

Details for d2qtia_

PDB Entry: 2qti, 2.3 Å

PDB Description: crystal structure of the upf0352 protein so_2176 from shewanella oneidensis. nesg target sor77.

PDB Compounds: (A:) UPF0352 protein SO_2176

SCOPe Domain Sequences for d2qtia_:

Sequence; same for both SEQRES and ATOM records:

>d2qtia_ a.284.1.1 (A:) Uncharacterized protein SO2176 {Shewanella oneidensis [TaxId: 70863]}
sntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeqfakalaq
svksnle

Timeline for d2qtia_:

• d2qtia_ first appeared in SCOP 1.75, called d2qtia1
  
• d2qtia_ appears in SCOPe 2.04
  
• d2qtia_ is called d2qtia2 in SCOPe 2.06
  
• d2qtia_ appears in the current release, SCOPe 2.08, called d2qtia2