| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
| Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
| Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species) E1A and E1B fused together in a single-chain protein |
| Species Escherichia coli [TaxId:562] [75240] (8 PDB entries) |
| Domain d2qtcb3: 2qtc B:701-886 [151348] Other proteins in same PDB: d2qtca1, d2qtca2, d2qtcb1, d2qtcb2 automated match to d2ieaa3 complexed with mg, tdk; mutant |
PDB Entry: 2qtc (more details), 1.77 Å
SCOPe Domain Sequences for d2qtcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtcb3 c.48.1.1 (B:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla
Timeline for d2qtcb3: