Lineage for d2qtca3 (2qtc A:701-886)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993790Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 993791Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 993792Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 993793Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 993794Species Escherichia coli [TaxId:562] [75240] (8 PDB entries)
  8. 993797Domain d2qtca3: 2qtc A:701-886 [151345]
    Other proteins in same PDB: d2qtca1, d2qtca2, d2qtcb1, d2qtcb2
    automatically matched to d1l8aa3
    complexed with mg, tdk; mutant

Details for d2qtca3

PDB Entry: 2qtc (more details), 1.77 Å

PDB Description: e. coli pyruvate dehydrogenase e1 component e401k mutant with phosphonolactylthiamin diphosphate
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2qtca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtca3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d2qtca3:

Click to download the PDB-style file with coordinates for d2qtca3.
(The format of our PDB-style files is described here.)

Timeline for d2qtca3: