SCOPe 2.06: Domain d2qtca1: 2qtc A:471-700

Lineage for d2qtca1 (2qtc A:471-700)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (20 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255574] (3 PDB entries)

8. Domain d2qtca1: 2qtc A:471-700 [151343]
   Other proteins in same PDB: d2qtca2, d2qtca3, d2qtcb2, d2qtcb3
   automated match to d2ieaa1
   complexed with mg, tdk; mutant

Details for d2qtca1

PDB Entry: 2qtc, 1.77 Å

PDB Description: e. coli pyruvate dehydrogenase e1 component e401k mutant with phosphonolactylthiamin diphosphate

PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2qtca1:

Sequence, based on SEQRES records:

>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records):

>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

Timeline for d2qtca1:

• d2qtca1 first appeared in SCOP 1.75
  
• d2qtca1 appears in SCOPe 2.05
  
• d2qtca1 appears in SCOPe 2.07
  
• d2qtca1 appears in the current release, SCOPe 2.08