Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Domain d2qtca1: 2qtc A:471-700 [151343] Other proteins in same PDB: d2qtca2, d2qtca3, d2qtcb2, d2qtcb3 automated match to d2ieaa1 complexed with mg, tdk; mutant |
PDB Entry: 2qtc (more details), 1.77 Å
SCOPe Domain Sequences for d2qtca1:
Sequence, based on SEQRES records: (download)
>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa
>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva vimhdglermygekqenvyyyittlnenyhmpa
Timeline for d2qtca1: