Lineage for d2qtca1 (2qtc A:471-700)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255574] (3 PDB entries)
  8. 2865275Domain d2qtca1: 2qtc A:471-700 [151343]
    Other proteins in same PDB: d2qtca2, d2qtca3, d2qtcb2, d2qtcb3
    automated match to d2ieaa1
    complexed with mg, tdk; mutant

Details for d2qtca1

PDB Entry: 2qtc (more details), 1.77 Å

PDB Description: e. coli pyruvate dehydrogenase e1 component e401k mutant with phosphonolactylthiamin diphosphate
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2qtca1:

Sequence, based on SEQRES records: (download)

>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d2qtca1 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOPe Domain Coordinates for d2qtca1:

Click to download the PDB-style file with coordinates for d2qtca1.
(The format of our PDB-style files is described here.)

Timeline for d2qtca1: