SCOPe 2.04: Domain d1moba_: 1mob A:

Lineage for d1moba_ (1mob A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (239 PDB entries)
   Uniprot P02185

8. Domain d1moba_: 1mob A: [15134]
   complexed with hem, so4; mutant

Details for d1moba_

PDB Entry: 1mob, 2.2 Å

PDB Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1moba_:

Sequence; same for both SEQRES and ATOM records:

>d1moba_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkggvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1moba_:

• d1moba_ first appeared (with stable ids) in SCOP 1.55, called d1mob__
  
• d1moba_ appears in SCOPe 2.03
  
• d1moba_ appears in SCOPe 2.05
  
• d1moba_ appears in the current release, SCOPe 2.08