Lineage for d2qtba1 (2qtb A:39-508)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807891Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 807975Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 807976Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 807983Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 807984Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
    Uniprot P27487 39-776
    Uniprot P27487
    Uniprot P27487
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 807993Domain d2qtba1: 2qtb A:39-508 [151339]
    Other proteins in same PDB: d2qtba2, d2qtbb2
    automatically matched to d1orva1
    complexed with 474, na, nag, ndg; mutant

Details for d2qtba1

PDB Entry: 2qtb (more details), 2.25 Å

PDB Description: human dipeptidyl peptidase iv/cd26 in complex with a 4-aryl cyclohexylalanine inhibitor
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2qtba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtba1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d2qtba1:

Click to download the PDB-style file with coordinates for d2qtba1.
(The format of our PDB-style files is described here.)

Timeline for d2qtba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qtba2