SCOP 1.57: Domain d2mga__: 2mga -

Lineage for d2mga__ (2mga -)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries)

8. Domain d2mga__: 2mga - [15133]

Details for d2mga__

PDB Entry: 2mga, 2.2 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mga__:

Sequence; same for both SEQRES and ATOM records:

>d2mga__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkggvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mga__:

• d2mga__ first appeared (with stable ids) in SCOP 1.55
  
• d2mga__ appears in SCOP 1.59
  
• d2mga__ appears in the current release, SCOPe 2.08, called d2mgaa_