Lineage for d2qssb_ (2qss B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300419Species Cow (Bos taurus) [TaxId:9913] [46506] (11 PDB entries)
  8. 2300420Domain d2qssb_: 2qss B: [151323]
    Other proteins in same PDB: d2qssa_, d2qssc_
    automated match to d1fsxb_
    complexed with cmo, hem

Details for d2qssb_

PDB Entry: 2qss (more details), 1.75 Å

PDB Description: Bovine hemoglobin at pH 6.3
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2qssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qssb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOPe Domain Coordinates for d2qssb_:

Click to download the PDB-style file with coordinates for d2qssb_.
(The format of our PDB-style files is described here.)

Timeline for d2qssb_: