![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries) |
![]() | Domain d2qssa_: 2qss A: [151322] Other proteins in same PDB: d2qssb_, d2qssd_ automated match to d1fsxa_ complexed with cmo, hem |
PDB Entry: 2qss (more details), 1.75 Å
SCOPe Domain Sequences for d2qssa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qssa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvltskyr
Timeline for d2qssa_: