Lineage for d2qspa_ (2qsp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686276Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries)
  8. 2686279Domain d2qspa_: 2qsp A: [151318]
    Other proteins in same PDB: d2qspb_, d2qspd_
    automated match to d1fsxa_
    complexed with hem

Details for d2qspa_

PDB Entry: 2qsp (more details), 1.85 Å

PDB Description: Bovine Hemoglobin at pH 5.7
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2qspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qspa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d2qspa_:

Click to download the PDB-style file with coordinates for d2qspa_.
(The format of our PDB-style files is described here.)

Timeline for d2qspa_: