Lineage for d2qsba1 (2qsb A:2-86)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2318464Superfamily a.29.14: Ta0600-like [158436] (1 family) (S)
    automatically mapped to Pfam PF03685
  5. 2318465Family a.29.14.1: Ta0600-like [158437] (2 protein domains)
    Pfam PF03685; UPF0147
  6. 2318472Protein Uncharacterized protein Ta0600 [158440] (1 species)
  7. 2318473Species Thermoplasma acidophilum [TaxId:2303] [158441] (1 PDB entry)
    Uniprot Q9HKJ8 2-86
  8. 2318474Domain d2qsba1: 2qsb A:2-86 [151315]
    complexed with so4

Details for d2qsba1

PDB Entry: 2qsb (more details), 1.3 Å

PDB Description: crystal structure of a protein from uncharacterized family upf0147 from thermoplasma acidophilum
PDB Compounds: (A:) UPF0147 protein Ta0600

SCOPe Domain Sequences for d2qsba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qsba1 a.29.14.1 (A:2-86) Uncharacterized protein Ta0600 {Thermoplasma acidophilum [TaxId: 2303]}
vrvdqnlfnevmylldelsqditvpknvrkvaqdskaklsqenesldlrcatvlsmldem
andpnvpahgrtdlytiiskleals

SCOPe Domain Coordinates for d2qsba1:

Click to download the PDB-style file with coordinates for d2qsba1.
(The format of our PDB-style files is described here.)

Timeline for d2qsba1: