Lineage for d2qs8b2 (2qs8 B:64-373)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1342018Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)
    automatically mapped to Pfam PF01979
  6. 1342029Protein Xaa-Pro dipeptidase [159409] (1 species)
  7. 1342030Species Alteromonas macleodii [TaxId:28108] [159410] (1 PDB entry)
  8. 1342032Domain d2qs8b2: 2qs8 B:64-373 [151314]
    Other proteins in same PDB: d2qs8a1, d2qs8b1
    automated match to d2qs8a2
    complexed with met, mg

Details for d2qs8b2

PDB Entry: 2qs8 (more details), 2.33 Å

PDB Description: crystal structure of a xaa-pro dipeptidase with bound methionine in the active site
PDB Compounds: (B:) Xaa-Pro Dipeptidase

SCOPe Domain Sequences for d2qs8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qs8b2 c.1.9.18 (B:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]}
glmdmhvhfgqeyqskaqapikveremqailatqhayvtfksgfttvrqvgdsglvaisl
rdainsgklagprifaagktiattgghadptngkavddydypvpeqgvvngpyevyaavr
qrykdgadgikitvtggvlsvaksgqnpqftqeevdavvsaakdygmwvavhahgaegmk
raikagvdsiehgtfmdleamdlmiengtyyvptisagefvaekskidnffpeivrpkaa
svgpqisdtfrkayekgvkiafgtdagvqkhgtnwkefvymvengmpamkaiqsatmeta
kllriedklg

SCOPe Domain Coordinates for d2qs8b2:

Click to download the PDB-style file with coordinates for d2qs8b2.
(The format of our PDB-style files is described here.)

Timeline for d2qs8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qs8b1