SCOP 1.75: Domain d2qrzb1: 2qrz B:1-187

Lineage for d2qrzb1 (2qrz B:1-187)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (19 PDB entries)

8. Domain d2qrzb1: 2qrz B:1-187 [151310]
   automatically matched to d1ajea_
   complexed with gcp, mg, so4

Details for d2qrzb1

PDB Entry: 2qrz, 2.4 Å

PDB Description: Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required

PDB Compounds: (B:) Cell division control protein 42 homolog precursor

SCOP Domain Sequences for d2qrzb1:

Sequence, based on SEQRES records:

>d2qrzb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrr

Sequence, based on observed residues (ATOM records):

>d2qrzb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk
ksrr

Timeline for d2qrzb1:

• d2qrzb1 is new in SCOP 1.75
  
• d2qrzb1 is called d2qrzb_ in SCOPe 2.01
  
• d2qrzb1 appears in the current release, SCOPe 2.08, called d2qrzb_