SCOP 1.73: Domain d2myaa_: 2mya A:

Lineage for d2myaa_ (2mya A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d2myaa_: 2mya A: [15131]
   complexed with enc, hem, so4

Details for d2myaa_

PDB Entry: 2mya, 2 Å

PDB Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes

PDB Compounds: (A:) myoglobin (ethyl isocyanide)

SCOP Domain Sequences for d2myaa_:

Sequence; same for both SEQRES and ATOM records:

>d2myaa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2myaa_:

• d2myaa_ first appeared (with stable ids) in SCOP 1.55, called d2mya__
  
• d2myaa_ was called d2mya__ in SCOP 1.71
  
• d2myaa_ appears in SCOP 1.75
  
• d2myaa_ appears in the current release, SCOPe 2.08