SCOPe 2.03: Domain d2qrec1: 2qre C:450-576

Lineage for d2qrec1 (2qre C:450-576)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (3 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
   PfamB PB166430

6. Protein Snf1-like protein kinase ssp2 [160726] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries)
   Uniprot O74536 449-576

8. Domain d2qrec1: 2qre C:450-576 [151292]
   Other proteins in same PDB: d2qreb1, d2qred1
   automatically matched to 2OOX A:449-576
   complexed with amz

Details for d2qrec1

PDB Entry: 2qre, 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)

PDB Compounds: (C:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d2qrec1:

Sequence, based on SEQRES records:

>d2qrec1 d.129.6.2 (C:450-576) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckre
gkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcaml
vcklfsa

Sequence, based on observed residues (ATOM records):

>d2qrec1 d.129.6.2 (C:450-576) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckre
gkntyayielqlyevmpgcfmldvksngykddlkssfpfldlcamlvcklfsa

Timeline for d2qrec1:

• d2qrec1 first appeared in SCOP 1.75
  
• d2qrec1 appears in SCOPe 2.02
  
• d2qrec1 is called d2qrec_ in SCOPe 2.04
  
• d2qrec1 appears in the current release, SCOPe 2.08, called d2qrec_