Lineage for d2qrea_ (2qre A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582738Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2582747Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2582755Protein Snf1-like protein kinase ssp2 [160726] (1 species)
  7. 2582756Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries)
    Uniprot O74536 449-576
  8. 2582765Domain d2qrea_: 2qre A: [151290]
    Other proteins in same PDB: d2qreb_, d2qred_, d2qree1, d2qree2, d2qree3, d2qreg1, d2qreg2, d2qreg3
    automated match to d2ooya_
    complexed with amz

Details for d2qrea_

PDB Entry: 2qre (more details), 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)
PDB Compounds: (A:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d2qrea_:

Sequence, based on SEQRES records: (download)

>d2qrea_ d.129.6.2 (A:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
kwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckreg
kntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcamlv
cklfsa

Sequence, based on observed residues (ATOM records): (download)

>d2qrea_ d.129.6.2 (A:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
kwhfgvrcrgdapeillavyralqragaqftvpkpvnsdmytiksrweiphckregknty
ayielqlyevmpgcfmldvksngykdiyskssfpfldlcamlvcklfsa

SCOPe Domain Coordinates for d2qrea_:

Click to download the PDB-style file with coordinates for d2qrea_.
(The format of our PDB-style files is described here.)

Timeline for d2qrea_: