SCOP 1.71: Domain d2mgh__: 2mgh -

Lineage for d2mgh__ (2mgh -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d2mgh__: 2mgh - [15129]
   complexed with hem, mto, so4; mutant

Details for d2mgh__

PDB Entry: 2mgh, 2 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mgh__:

Sequence; same for both SEQRES and ATOM records:

>d2mgh__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mgh__:

• d2mgh__ first appeared (with stable ids) in SCOP 1.55
  
• d2mgh__ appears in SCOP 1.69
  
• d2mgh__ is called d2mgha_ in SCOP 1.73
  
• d2mgh__ appears in the current release, SCOPe 2.08, called d2mgha_