Lineage for d105m__ (105m -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436886Protein Myoglobin [46469] (9 species)
  7. 436959Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 437085Domain d105m__: 105m - [15128]

Details for d105m__

PDB Entry: 105m (more details), 2.02 Å

PDB Description: sperm whale myoglobin n-butyl isocyanide at ph 9.0

SCOP Domain Sequences for d105m__:

Sequence; same for both SEQRES and ATOM records: (download)

>d105m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d105m__:

Click to download the PDB-style file with coordinates for d105m__.
(The format of our PDB-style files is described here.)

Timeline for d105m__: