SCOPe 2.07: Domain d1ch5a1: 1ch5 A:1-153

Lineage for d1ch5a1 (1ch5 A:1-153)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
   Uniprot P02185

8. Domain d1ch5a1: 1ch5 A:1-153 [15127]
   Other proteins in same PDB: d1ch5a2
   complexed with hem, so4; mutant

Details for d1ch5a1

PDB Entry: 1ch5, 2.1 Å

PDB Description: recombinant sperm whale myoglobin h97v mutant (met)

PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1ch5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ch5a1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkvkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1ch5a1:

• d1ch5a1 first appeared (with stable ids) in SCOP 1.55, called d1ch5a_
  
• d1ch5a1 appears in SCOPe 2.06
  
• d1ch5a1 appears in the current release, SCOPe 2.08