Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d2qr0s2: 2qr0 S:108-211 [151265] Other proteins in same PDB: d2qr0a1, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0x1, d2qr0x2 automatically matched to d1g9ml2 |
PDB Entry: 2qr0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qr0s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr0s2 b.1.1.2 (S:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2qr0s2:
View in 3D Domains from other chains: (mouse over for more information) d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2 |