Lineage for d2qr0r1 (2qr0 R:12-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757747Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1757837Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries)
  8. 1757847Domain d2qr0r1: 2qr0 R:12-111 [151262]
    Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x2
    automatically matched to d1hxma1

Details for d2qr0r1

PDB Entry: 2qr0 (more details), 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs
PDB Compounds: (R:) Fab-Fragment Heavy Chain

SCOPe Domain Sequences for d2qr0r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr0r1 b.1.1.1 (R:12-111) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
vqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsyadsvkgrftis
adtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtv

SCOPe Domain Coordinates for d2qr0r1:

Click to download the PDB-style file with coordinates for d2qr0r1.
(The format of our PDB-style files is described here.)

Timeline for d2qr0r1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qr0r2