Lineage for d2qr0m2 (2qr0 M:108-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 protein domains)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786055Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
    SQ NA # humanized antibody
    Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
    SQ P01834 # KAC_HUMAN Ig kappa chain C region.
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 786252Domain d2qr0m2: 2qr0 M:108-211 [151255]
    Other proteins in same PDB: d2qr0a1, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0x1, d2qr0x2
    automatically matched to d1g9ml2

Details for d2qr0m2

PDB Entry: 2qr0 (more details), 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs
PDB Compounds: (M:) Fab-Fragment Light Chain

SCOP Domain Sequences for d2qr0m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr0m2 b.1.1.2 (M:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d2qr0m2:

Click to download the PDB-style file with coordinates for d2qr0m2.
(The format of our PDB-style files is described here.)

Timeline for d2qr0m2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qr0m1