SCOP 1.75: Domain d2qr0l2: 2qr0 L:114-216

Lineage for d2qr0l2 (2qr0 L:114-216)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2qr0l2: 2qr0 L:114-216 [151253]
   Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b1, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x1
   automatically matched to d1ngzb2

Details for d2qr0l2

PDB Entry: 2qr0, 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs

PDB Compounds: (L:) Fab-Fragment Heavy Chain

SCOP Domain Sequences for d2qr0l2:

Sequence, based on SEQRES records:

>d2qr0l2 b.1.1.2 (L:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d2qr0l2 b.1.1.2 (L:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d2qr0l2:

• d2qr0l2 is new in SCOP 1.75
  
• d2qr0l2 appears in SCOPe 2.01
  
• d2qr0l2 appears in the current release, SCOPe 2.08