SCOP 1.75: Domain d2qr0i1: 2qr0 I:13-107

Lineage for d2qr0i1 (2qr0 I:13-107)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
   Uniprot P15692 40-133

8. Domain d2qr0i1: 2qr0 I:13-107 [151248]
   Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2
   automatically matched to d1katv_

Details for d2qr0i1

PDB Entry: 2qr0, 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs

PDB Compounds: (I:) Vascular Endothelial Growth Factor A

SCOP Domain Sequences for d2qr0i1:

Sequence; same for both SEQRES and ATOM records:

>d2qr0i1 g.17.1.1 (I:13-107) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

Timeline for d2qr0i1:

• d2qr0i1 is new in SCOP 1.75
  
• d2qr0i1 appears in SCOPe 2.01
  
• d2qr0i1 appears in the current release, SCOPe 2.08