Lineage for d103m__ (103m -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d103m__: 103m - [15124]
Details for d103m__
PDB Entry: 103m (more details), 2.07 Å
PDB Description: sperm whale myoglobin h64a n-butyl isocyanide at ph 9.0
SCOP Domain Sequences for d103m__:
Sequence; same for both SEQRES and ATOM records: (download)
>d103m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d103m__:
Click to download the PDB-style file with coordinates for d103m__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d103m__:
- d103m__ appears in SCOP 1.57
- d103m__ appears in the current release, SCOPe 2.08, called d103ma_
View in 3D