SCOP 1.75: Domain d2qr0b1: 2qr0 B:12-111

Lineage for d2qr0b1 (2qr0 B:12-111)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries)

8. Domain d2qr0b1: 2qr0 B:12-111 [151236]
   Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x2
   automatically matched to d1hxma1

Details for d2qr0b1

PDB Entry: 2qr0, 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs

PDB Compounds: (B:) Fab-Fragment Heavy Chain

SCOP Domain Sequences for d2qr0b1:

Sequence; same for both SEQRES and ATOM records:

>d2qr0b1 b.1.1.1 (B:12-111) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
vqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsyadsvkgrftis
adtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtv

Timeline for d2qr0b1:

• d2qr0b1 is new in SCOP 1.75
  
• d2qr0b1 appears in SCOPe 2.01
  
• d2qr0b1 appears in the current release, SCOPe 2.08