SCOPe 2.07: Domain d2qqra2: 2qqr A:956-1011

Lineage for d2qqra2 (2qqr A:956-1011)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein Jumonji domain-containing protein 2A [141203] (1 species)
   contains tandem repeat of two segment-swapped Tudor domains

7. Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
   Uniprot O75164 897-955! Uniprot O75164 956-1011

8. Domain d2qqra2: 2qqr A:956-1011 [151227]
   Other proteins in same PDB: d2qqra3, d2qqrb3
   automated match to d2qqra2
   complexed with so4

Details for d2qqra2

PDB Entry: 2qqr, 1.8 Å

PDB Description: JMJD2A hybrid tudor domains

PDB Compounds: (A:) JmjC domain-containing histone demethylation protein 3A

SCOPe Domain Sequences for d2qqra2:

Sequence; same for both SEQRES and ATOM records:

>d2qqra2 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp

Timeline for d2qqra2:

• d2qqra2 first appeared in SCOP 1.75
  
• d2qqra2 appears in SCOPe 2.06
  
• d2qqra2 appears in the current release, SCOPe 2.08