SCOP 1.75: Domain d2qqma3: 2qqm A:156-263

Lineage for d2qqma3 (2qqm A:156-263)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (1 family)

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)

6. Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
   duplication: contains two CUB domains separated by an EGF-like domain

7. Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries)
   Uniprot O00187 17-181

8. Domain d2qqma3: 2qqm A:156-263 [151222]
   Other proteins in same PDB: d2qqma1, d2qqma2
   automatically matched to d1szba1
   complexed with ca, edo, fuc, nag

Details for d2qqma3

PDB Entry: 2qqm, 2 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-1

PDB Compounds: (A:) Neuropilin-1

SCOP Domain Sequences for d2qqma3:

Sequence, based on SEQRES records:

>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
gvikspgfpekypnslectyivfapkmseiilefesfdlepdsnppggmfcrydrleiwd
gfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

Sequence, based on observed residues (ATOM records):

>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
gvikspgfpekypnslectyivfapkmseiilefesfdlepdggmfcrydrleiwdgfpd
vgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

Timeline for d2qqma3:

• d2qqma3 is new in SCOP 1.75
  
• d2qqma3 appears in SCOPe 2.01
  
• d2qqma3 appears in the current release, SCOPe 2.08