SCOPe 2.08: Domain d2qqma3: 2qqm A:145-263

Lineage for d2qqma3 (2qqm A:145-263)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)

6. Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
   duplication: contains two CUB domains separated by an EGF-like domain

7. Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries)
   Uniprot O00187 17-181

8. Domain d2qqma3: 2qqm A:145-263 [151222]
   Other proteins in same PDB: d2qqma1, d2qqma2
   automated match to d2qqma3
   complexed with ca, edo

Details for d2qqma3

PDB Entry: 2qqm, 2 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-1

PDB Compounds: (A:) Neuropilin-1

SCOPe Domain Sequences for d2qqma3:

Sequence, based on SEQRES records:

>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdsnppggm
fcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

Sequence, based on observed residues (ATOM records):

>d2qqma3 b.23.1.1 (A:145-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdggmfcry
drleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanys

Timeline for d2qqma3:

• d2qqma3 first appeared in SCOP 1.75
  
• d2qqma3 appears in SCOPe 2.07