![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein C2 domain of factor VIII [49794] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries) |
![]() | Domain d2qqma2: 2qqm A:275-430 [151221] Other proteins in same PDB: d2qqma3 automated match to d2qqma1 complexed with ca, edo |
PDB Entry: 2qqm (more details), 2 Å
SCOPe Domain Sequences for d2qqma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqma2 b.18.1.2 (A:275-430) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} cmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgllr fvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvvav fpkplitrfvrikpatwetgismrfevygckitdyp
Timeline for d2qqma2: