Lineage for d2qqma1 (2qqm A:431-586)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383809Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2383841Protein C2 domain of factor VIII [49794] (1 species)
  7. 2383842Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries)
  8. 2383847Domain d2qqma1: 2qqm A:431-586 [151220]
    Other proteins in same PDB: d2qqma3
    automated match to d2qqma1
    complexed with ca, edo, fuc, nag

Details for d2qqma1

PDB Entry: 2qqm (more details), 2 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-1
PDB Compounds: (A:) Neuropilin-1

SCOPe Domain Sequences for d2qqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqma1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}
csgmlgmvsglisdsqitssnqgdrnwmpenirlvtsrsgwalppaphsyinewlqidlg
eekivrgiiiqggkhrenkvfmrkfkigysnngsdwkmimddskrkaksfegnnnydtpe
lrtfpalstrfiriyperathgglglrmellgceve

SCOPe Domain Coordinates for d2qqma1:

Click to download the PDB-style file with coordinates for d2qqma1.
(The format of our PDB-style files is described here.)

Timeline for d2qqma1: