![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein C2 domain of factor VIII [49794] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries) |
![]() | Domain d2qqia1: 2qqi A:427-586 [151218] Other proteins in same PDB: d2qqia3 automated match to d1sddb4 complexed with gol |
PDB Entry: 2qqi (more details), 1.8 Å
SCOPe Domain Sequences for d2qqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqia1 b.18.1.2 (A:427-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} tdypcsgmlgmvsglisdsqitssnqgdrnwmpenirlvtsrsgwalppaphsyinewlq idlgeekivrgiiiqggkhrenkvfmrkfkigysnngsdwkmimddskrkaksfegnnny dtpelrtfpalstrfiriyperathgglglrmellgceve
Timeline for d2qqia1: