| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.8: Atu1531-like [160742] (3 proteins) Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport |
| Protein Uncharacterized protein Atu1531 [160745] (1 species) |
| Species Agrobacterium tumefaciens [TaxId:358] [160746] (1 PDB entry) Uniprot Q7CZ16 1-133 |
| Domain d2qpvb_: 2qpv B: [151216] automated match to d2qpva1 complexed with acy |
PDB Entry: 2qpv (more details), 2.35 Å
SCOPe Domain Sequences for d2qpvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpvb_ d.129.3.8 (B:) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]}
mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrv
nfaphnefgvidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasai
tadlemlksllea
Timeline for d2qpvb_: