Lineage for d2qpsa1 (2qps A:348-404)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810735Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2810736Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries)
  8. 2810745Domain d2qpsa1: 2qps A:348-404 [151207]
    Other proteins in same PDB: d2qpsa2
    automated match to d1ht6a1
    complexed with ca; mutant

    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d2qpsa1

PDB Entry: 2qps (more details), 2.2 Å

PDB Description: "Sugar tongs" mutant Y380A in complex with acarbose
PDB Compounds: (A:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d2qpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpsa1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwek

SCOPe Domain Coordinates for d2qpsa1:

Click to download the PDB-style file with coordinates for d2qpsa1.
(The format of our PDB-style files is described here.)

Timeline for d2qpsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qpsa2