Lineage for d2qpla_ (2qpl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888669Species Cow (Bos taurus) [TaxId:9913] [187265] (1 PDB entry)
  8. 2888670Domain d2qpla_: 2qpl A: [151206]
    automated match to d1a9oa_
    complexed with bty, mg, so4

Details for d2qpla_

PDB Entry: 2qpl (more details), 2.1 Å

PDB Description: Crystal structure of calf spleen purine nucleoside phosphorylase complexed to a novel purine analogue
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2qpla_:

Sequence, based on SEQRES records: (download)

>d2qpla_ c.56.2.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvp
ghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnp
nfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmg
eqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslit
nkvimdyesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records): (download)

>d2qpla_ c.56.2.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpeghag
rlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfev
gdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqre
lqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvi
mdyeagkqaaqkleqfvsllmasipv

SCOPe Domain Coordinates for d2qpla_:

Click to download the PDB-style file with coordinates for d2qpla_.
(The format of our PDB-style files is described here.)

Timeline for d2qpla_: