SCOP 1.75: Domain d2qpec1: 2qpe C:2-34

Lineage for d2qpec1 (2qpe C:2-34)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family)

5. Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
   functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II

7. Species Thermus thermophilus [TaxId:274] [81470] (5 PDB entries)

8. Domain d2qpec1: 2qpe C:2-34 [151204]
   Other proteins in same PDB: d2qpeb1, d2qpeb2
   automatically matched to d1ehkc_
   complexed with cu1, cua, has, hem; mutant

Details for d2qpec1

PDB Entry: 2qpe, 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOP Domain Sequences for d2qpec1:

Sequence; same for both SEQRES and ATOM records:

>d2qpec1 f.23.9.1 (C:2-34) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

Timeline for d2qpec1:

• d2qpec1 is new in SCOP 1.75
  
• d2qpec1 appears in SCOPe 2.01
  
• d2qpec1 appears in the current release, SCOPe 2.08, called d2qpec_