Lineage for d2qpdb1 (2qpd B:37-168)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791487Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 791488Protein Cytochrome c oxidase [49544] (4 species)
  7. 791531Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries)
  8. 791539Domain d2qpdb1: 2qpd B:37-168 [151199]
    Other proteins in same PDB: d2qpdb2, d2qpdc1
    automatically matched to d2cuab_
    complexed with cu1, cua, has, hem; mutant

Details for d2qpdb1

PDB Entry: 2qpd (more details), 3.25 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2qpdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpdb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOP Domain Coordinates for d2qpdb1:

Click to download the PDB-style file with coordinates for d2qpdb1.
(The format of our PDB-style files is described here.)

Timeline for d2qpdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qpdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2qpdc1