SCOPe 2.08: Domain d2qpdb1: 2qpd B:37-168

Lineage for d2qpdb1 (2qpd B:37-168)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)

8. Domain d2qpdb1: 2qpd B:37-168 [151199]
   Other proteins in same PDB: d2qpdb2, d2qpdc1
   automatically matched to d2cuab_
   complexed with cu1, cua, has, hem

Details for d2qpdb1

PDB Entry: 2qpd, 3.25 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpdb1:

Sequence; same for both SEQRES and ATOM records:

>d2qpdb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d2qpdb1:

• d2qpdb1 first appeared in SCOP 1.75
  
• d2qpdb1 appears in SCOPe 2.07