Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
Species Escherichia coli [TaxId:562] [141994] (29 PDB entries) Uniprot P02413 1-144 |
Domain d2qp1l1: 2qp1 L:2-144 [151181] Other proteins in same PDB: d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1c2, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1i1, d2qp1i2, d2qp1j1, d2qp1k1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1 protein/RNA complex; complexed with mg, nmy, zn protein/RNA complex; complexed with mg, nmy, zn |
PDB Entry: 2qp1 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp1l1 c.12.1.1 (L:2-144) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} rlntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrrl pkfgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvt vrglrvtkgaraaieaaggkiee
Timeline for d2qp1l1:
View in 3D Domains from other chains: (mouse over for more information) d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1c2, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1i1, d2qp1i2, d2qp1j1, d2qp1k1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1 |