![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160201] (29 PDB entries) Uniprot P0A7J7 1-72 |
![]() | Domain d2qp1i2: 2qp1 I:1-72 [151178] Other proteins in same PDB: d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1c2, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1i1, d2qp1j1, d2qp1k1, d2qp1l1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1 protein/RNA complex; complexed with mg, nmy, zn protein/RNA complex; complexed with mg, nmy, zn |
PDB Entry: 2qp1 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp1i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp1i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv yadrsftfvtkt
Timeline for d2qp1i2:
![]() Domains from other chains: (mouse over for more information) d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1c2, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1j1, d2qp1k1, d2qp1l1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1 |