Lineage for d2qp1i2 (2qp1 I:1-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946692Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2946700Domain d2qp1i2: 2qp1 I:1-72 [151178]
    Other proteins in same PDB: d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1c2, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1i1, d2qp1j1, d2qp1k1, d2qp1l1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1
    protein/RNA complex; complexed with mg, nmy, zn
    protein/RNA complex; complexed with mg, nmy, zn

Details for d2qp1i2

PDB Entry: 2qp1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qp1i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp1i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2qp1i2:

Click to download the PDB-style file with coordinates for d2qp1i2.
(The format of our PDB-style files is described here.)

Timeline for d2qp1i2: