Lineage for d2qp1c2 (2qp1 C:61-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789812Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2789822Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2789830Domain d2qp1c2: 2qp1 C:61-124 [151169]
    Other proteins in same PDB: d2qp101, d2qp111, d2qp131, d2qp141, d2qp1c1, d2qp1d1, d2qp1e1, d2qp1f1, d2qp1g1, d2qp1g2, d2qp1h1, d2qp1h2, d2qp1i1, d2qp1i2, d2qp1j1, d2qp1k1, d2qp1l1, d2qp1m1, d2qp1n1, d2qp1o1, d2qp1p1, d2qp1q1, d2qp1r1, d2qp1s1, d2qp1t1, d2qp1u1, d2qp1v1, d2qp1w1, d2qp1x1, d2qp1y1, d2qp1z1
    protein/RNA complex; complexed with mg, nmy, zn
    protein/RNA complex; complexed with mg, nmy, zn

    missing some secondary structures that made up less than one-third of the common domain

Details for d2qp1c2

PDB Entry: 2qp1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qp1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp1c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d2qp1c2:

Click to download the PDB-style file with coordinates for d2qp1c2.
(The format of our PDB-style files is described here.)

Timeline for d2qp1c2: