![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) ![]() |
![]() | Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
![]() | Protein Ribosomal protein S21, RpsU [161310] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
![]() | Domain d2qp0u1: 2qp0 U:3-53 [151163] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1 automatically matched to 2AVY U:3-53 protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2qp0u1: