Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Escherichia coli [TaxId:562] [159907] (26 PDB entries) Uniprot P0A7X3 3-129 |
Domain d2qp0i1: 2qp0 I:3-129 [151152] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0i1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr rpqfskr
Timeline for d2qp0i1: