Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
Domain d2qp0f1: 2qp0 F:1-100 [151149] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0f1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2qp0f1: