Lineage for d2qp0f1 (2qp0 F:1-100)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206291Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1206292Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1206293Protein Ribosomal protein S6 [54997] (4 species)
  7. 1206296Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1206302Domain d2qp0f1: 2qp0 F:1-100 [151149]
    Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0f1

PDB Entry: 2qp0 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qp0f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp0f1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qp0f1:

Click to download the PDB-style file with coordinates for d2qp0f1.
(The format of our PDB-style files is described here.)

Timeline for d2qp0f1: