Lineage for d2qp0e2 (2qp0 E:9-77)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904351Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 1904352Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1904355Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
    Uniprot P0A7W1 9-77
  8. 1904361Domain d2qp0e2: 2qp0 E:9-77 [151148]
    Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
    protein/RNA complex; complexed with mg, nmy, scm
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0e2

PDB Entry: 2qp0 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qp0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp0e2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

SCOPe Domain Coordinates for d2qp0e2:

Click to download the PDB-style file with coordinates for d2qp0e2.
(The format of our PDB-style files is described here.)

Timeline for d2qp0e2: