SCOP 1.75: Domain d2qozi1: 2qoz I:73-141

Lineage for d2qozi1 (2qoz I:73-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d2qozi1: 2qoz I:73-141 [151124]
   Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc1, d2qozc2, d2qozd1, d2qoze1, d2qozf1, d2qozg1, d2qozg2, d2qozh1, d2qozh2, d2qozi2, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
   automatically matched to 2AW4 I:73-141
   complexed with mg, nmy, zn

Details for d2qozi1

PDB Entry: 2qoz, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d2qozi1:

Sequence; same for both SEQRES and ATOM records:

>d2qozi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d2qozi1:

• d2qozi1 is new in SCOP 1.75
  
• d2qozi1 appears in SCOPe 2.01
  
• d2qozi1 appears in the current release, SCOPe 2.08